Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human E3 ubiquitin-protein ligase RING1 (RING1), Biotinylated

This Recombinant Human E3 ubiquitin-protein ligase RING1 (RING1), Biotinylated spans the amino acid sequence from region 1-406. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

E3 ubiquitin-protein ligase RING1; EC 2.3.2.27; Polycomb complex protein RING1; RING finger protein 1; RING-type E3 ubiquitin transferase RING1; Really interesting new gene 1 protein; RING1 RING1A RNF1

UniProt

Q06587

Expression Region

1-406

Origin

Homo sapiens (Human)

Field of Research

Epigenetics & Chromatin; Molecular Biology

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MTTPANAQNASKTWELSLYELHRTPQEAIMDGTEIAVSPRSLHSELMCPICLDMLKNTMTTKECLHRFCSDCIVTALRSGNKECPTCRKKLVSKRSLRPDPNFDALISKIYPSREEYEAHQDRVLIRLSRLHNQQALSSSIEEGLRMQAMHRAQRVRRPIPGSDQTTTMSGGEGEPGEGEGDGEDVSSDSAPDSAPGPAPKRPRGGGAGGSSVGTGGGGTGGVGGGAGSEDSGDRGGTLGGGTLGPPSPPGAPSPPEPGGEIELVFRPHPLLVEKGEYCQTRYVKTTGNATVDHLSKYLALRIALERRQQQEAGEPGGPGGGASDTGGPDGCGGEGGGAGGGDGPEEPALPSLEGVSEKQYTIYIAPGGGAFTTLNGSLTLELVNEKFWKVSRPLELCYAPTKDPK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Thieno[3,2-b]pyridine-7-carbonitrile
OR303257 1 Each

Thieno[3,2-b]pyridine-7-carbonitrile

Sign In for Pricing
View Details
Recombinant Escherichia coli O17:K52:H18 Tryptophan synthase alpha chain (trpA)
MBS1015649-01 0.02 mg (E-Coli)

Recombinant Escherichia coli O17:K52:H18 Tryptophan synthase alpha chain (trpA)

Sign In for Pricing
View Details
Recombinant Escherichia coli O17:K52:H18 Tryptophan synthase alpha chain (trpA)
MBS1015649-02 0.02 mg (Yeast)

Recombinant Escherichia coli O17:K52:H18 Tryptophan synthase alpha chain (trpA)

Sign In for Pricing
View Details
Recombinant Escherichia coli O17:K52:H18 Tryptophan synthase alpha chain (trpA)
MBS1015649-03 0.1 mg (E-Coli)

Recombinant Escherichia coli O17:K52:H18 Tryptophan synthase alpha chain (trpA)

Sign In for Pricing
View Details
Recombinant Escherichia coli O17:K52:H18 Tryptophan synthase alpha chain (trpA)
MBS1015649-04 0.1 mg (Yeast)

Recombinant Escherichia coli O17:K52:H18 Tryptophan synthase alpha chain (trpA)

Sign In for Pricing
View Details
Recombinant Escherichia coli O17:K52:H18 Tryptophan synthase alpha chain (trpA)
MBS1015649-05 0.02 mg (Baculovirus)

Recombinant Escherichia coli O17:K52:H18 Tryptophan synthase alpha chain (trpA)

Sign In for Pricing
View Details