Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Sodium channel regulatory subunit beta-1 (SCN1B), partial, Biotinylated

This Recombinant Human Sodium channel regulatory subunit beta-1 (SCN1B), partial, Biotinylated spans the amino acid sequence from region 19-157. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Sodium channel regulatory subunit beta-1 SCN1B

UniProt

Q07699

Expression Region

19-157

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

GGCVEVDSETEAVYGMTFKILCISCKRRSETNAETFTEWTFRQKGTEEFVKILRYENEVLQLEEDERFEGRVVWNGSRGTKDLQDLSIFITNVTYNHSGDYECHVYRLLFFENYEHNTSVVKKIHIEVVDKANRDMASI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Serine/Arginine Rich Splicing Factor 2 (SRSF2) ELISA Kit
MBS4502649-01 48 Tests

Human Serine/Arginine Rich Splicing Factor 2 (SRSF2) ELISA Kit

Sign In for Pricing
View Details
Human Serine/Arginine Rich Splicing Factor 2 (SRSF2) ELISA Kit
MBS4502649-02 96 Tests

Human Serine/Arginine Rich Splicing Factor 2 (SRSF2) ELISA Kit

Sign In for Pricing
View Details
Human Serine/Arginine Rich Splicing Factor 2 (SRSF2) ELISA Kit
MBS4502649-03 5x 96 Tests

Human Serine/Arginine Rich Splicing Factor 2 (SRSF2) ELISA Kit

Sign In for Pricing
View Details
Human Serine/Arginine Rich Splicing Factor 2 (SRSF2) ELISA Kit
MBS4502649-04 10x 96 Tests

Human Serine/Arginine Rich Splicing Factor 2 (SRSF2) ELISA Kit

Sign In for Pricing
View Details
PDE9A Lentiviral Vector (Mouse) (CMV) (pLenti-GIII-CMV)
36299064 1.0 µg DNA

PDE9A Lentiviral Vector (Mouse) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
KCNK2 Adenovirus (Rat)
25399056 1.0 mL

KCNK2 Adenovirus (Rat)

Sign In for Pricing
View Details