Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human 3',5'-cyclic-AMP phosphodiesterase 4D (PDE4D), partial, Biotinylated

This Recombinant Human 3',5'-cyclic-AMP phosphodiesterase 4D (PDE4D), partial, Biotinylated spans the amino acid sequence from region 386-715. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

3',5'-cyclic-AMP phosphodiesterase 4D; EC 3.1.4.53; DPDE3; PDE43; cAMP-specific phosphodiesterase 4D; PDE4D DPDE3

UniProt

Q08499

Expression Region

386-715

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

VKTEQEDVLAKELEDVNKWGLHVFRIAELSGNRPLTVIMHTIFQERDLLKTFKIPVDTLITYLMTLEDHYHADVAYHNNIHAADVVQSTHVLLSTPALEAVFTDLEILAAIFASAIHDVDHPGVSNQFLINTNSELALMYNDSSVLENHHLAVGFKLLQEENCDIFQNLTKKQRQSLRKMVIDIVLATDMSKHMNLLADLKTMVETKKVTSSGVLLLDNYSDRIQVLQNMVHCADLSNPTKPLQLYRQWTDRIMEEFFRQGDRERERGMEISPMCDKHNASVEKSQVGFIDYIVHPLWETWADLVHPDAQDILDTLEDNREWYQSTIPQS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Dehydroepiandrosterone sulfate (DHEA-S) ELISA Kit
QY-E11040 96 Tests

Rat Dehydroepiandrosterone sulfate (DHEA-S) ELISA Kit

Sign In for Pricing
View Details
CD1a Recombinant Antibody AE00242
AE00242 0.1mg

CD1a Recombinant Antibody AE00242

Sign In for Pricing
View Details
MYCBP2 Protein Vector (Rat) (pPB-N-His)
PV283851 500 ng

MYCBP2 Protein Vector (Rat) (pPB-N-His)

Sign In for Pricing
View Details
Rabbit Polyclonal RPC62 Antibody [DyLight 680]
NBP1-71821FR 0.1 mL

Rabbit Polyclonal RPC62 Antibody [DyLight 680]

Sign In for Pricing
View Details
RNF185 Antibody
25-861 100 µL

RNF185 Antibody

Sign In for Pricing
View Details
Mouse Peli1 activation kit by CRISPRa
GA207221 1 Kit

Mouse Peli1 activation kit by CRISPRa

Sign In for Pricing
View Details