Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human CMRF35-like molecule 6 (CLM6), partial, Biotinylated

This Recombinant Human CMRF35-like molecule 6 (CLM6), partial, Biotinylated spans the amino acid sequence from region 21-183. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

CMRF35-like molecule 6; CLM-6; CD300 antigen-like family member C; CMRF35-A1; CMRF-35; Immunoglobulin superfamily member 16; IgSF16; CD antigen CD300c; CD300C CMRF35 CMRF35A CMRF35A1 IGSF16

UniProt

Q08708

Expression Region

21-183

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

GYFPLSHPMTVAGPVGGSLSVQCRYEKEHRTLNKFWCRPPQILRCDKIVETKGSAGKRNGRVSIRDSPANLSFTVTLENLTEEDAGTYWCGVDTPWLRDFHDPIVEVEVSVFPAGTTTASSPQSSMGTSGPPTKLPVHTWPSVTRKDSPEPSPHPGSLFSNVR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human OSGIN1 activation kit by CRISPRa
GA109333 1 Kit

Human OSGIN1 activation kit by CRISPRa

Sign In for Pricing
View Details
SIRT1 Antibody (Biotin)
KB-974-01 50 μL

SIRT1 Antibody (Biotin)

Sign In for Pricing
View Details
SIRT1 Antibody (Biotin)
KB-974-02 100 µL

SIRT1 Antibody (Biotin)

Sign In for Pricing
View Details
SIRT1 Antibody (Biotin)
KB-974-03 1 mL

SIRT1 Antibody (Biotin)

Sign In for Pricing
View Details
Tas2r138 Mouse Gene Knockout Kit (CRISPR)
KN517219 1 Kit

Tas2r138 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
alpha-Fluoro-beta-alanine
TRC-F587350-25MG 25 mg

alpha-Fluoro-beta-alanine

Sign In for Pricing
View Details