Recombinant Human Calmodulin-regulated spectrin-associated protein 2 (CAMP2), partial, Biotinylated
This Recombinant Human Calmodulin-regulated spectrin-associated protein 2 (CAMP2), partial, Biotinylated spans the amino acid sequence from region 1349-1483. Purity: Greater than 85% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
Calmodulin-regulated spectrin-associated protein 2; Calmodulin-regulated spectrin-associated protein 1-like protein 1; CAMSAP2 CAMSAP1L1 KIAA1078
UniProt
Q08AD1
Expression Region
1349-1483
Origin
Homo sapiens (Human)
Endotoxin
Not test
Purity
Greater than 85% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Storage Conditions
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
AA Sequence
GPKLYKEPSAKSNKHIIQNALAHCCLAGKVNEGQKKKILEEMEKSDANNFLILFRDSGCQFRSLYTYCPETEEINKLTGIGPKSITKKMIEGLYKYNSDRKQFSHIPAKTLSASVDAITIHSHLWQTKRPVTPKK
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
SC401090 10 µg
Mir483 Mouse MicroRNA Expression Plasmid (MI0003484)
Sign In for Pricing
View Details 
MBS2037049-01 0.1 mL
PE-Linked Polyclonal Antibody to Interleukin 6 (IL6)
Sign In for Pricing
View Details MBS2037049-02 0.2 mL
PE-Linked Polyclonal Antibody to Interleukin 6 (IL6)
Sign In for Pricing
View Details MBS2037049-03 0.5 mL
PE-Linked Polyclonal Antibody to Interleukin 6 (IL6)
Sign In for Pricing
View Details MBS2037049-04 1 mL
PE-Linked Polyclonal Antibody to Interleukin 6 (IL6)
Sign In for Pricing
View Details