Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Mitotic-spindle organizing protein 1 (MZT1), Biotinylated

This Recombinant Human Mitotic-spindle organizing protein 1 (MZT1), Biotinylated spans the amino acid sequence from region 2-82. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Mitotic-spindle organizing protein 1; Mitotic-spindle organizing protein associated with a ring of gamma-tubulin 1; MZT1 C13orf37 MOZART1

UniProt

Q08AG7

Expression Region

2-82

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

ASSSGAGAAAAAAAANLNAVRETMDVLLEISRILNTGLDMETLSICVRLCEQGINPEALSSVIKELRKATEALKAAENMTS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CRBN Recombinant Protein (Mouse)
OPCA04681-20UG 20 µg

CRBN Recombinant Protein (Mouse)

Sign In for Pricing
View Details
Meso-Tetra (2-pyridyl) porphine
OR55188-01 100 mg

Meso-Tetra (2-pyridyl) porphine

Sign In for Pricing
View Details
Meso-Tetra (2-pyridyl) porphine
OR55188-02 250 mg

Meso-Tetra (2-pyridyl) porphine

Sign In for Pricing
View Details
Meso-Tetra (2-pyridyl) porphine
OR55188-03 1 g

Meso-Tetra (2-pyridyl) porphine

Sign In for Pricing
View Details
Meso-Tetra (2-pyridyl) porphine
OR55188-04 5 g

Meso-Tetra (2-pyridyl) porphine

Sign In for Pricing
View Details
Meso-Tetra (2-pyridyl) porphine
OR55188-05 10 g

Meso-Tetra (2-pyridyl) porphine

Sign In for Pricing
View Details