Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human ATP-binding cassette sub-family C member 8 (ABCC8), partial, Biotinylated

This Recombinant Human ATP-binding cassette sub-family C member 8 (ABCC8), partial, Biotinylated spans the amino acid sequence from region 320-356. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

ATP-binding cassette sub-family C member 8; Sulfonylurea receptor 1; ABCC8 HRINS SUR SUR1

UniProt

Q09428

Expression Region

320-356

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

IFGIVDHLGKENDVFQPKTQFLGVYFVSSQEFLANAY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Folic Acid
40600064-1 25 g

Folic Acid

Sign In for Pricing
View Details
SAPK3 (MAPK12) (NM_002969) Human Over-expression Lysate
LS006300 100 µg

SAPK3 (MAPK12) (NM_002969) Human Over-expression Lysate

Sign In for Pricing
View Details
Parp6 ORF Vector (Mouse) (pORF)
36038014 1.0 µg DNA

Parp6 ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details
Customer makes own cell line hosting HR Reporter (I-Sce Transfectn req.)  Includes HRHeLa cell line control (250ug DNA)
DR3000-Custom-Sce2 250ug DNA

Customer makes own cell line hosting HR Reporter (I-Sce Transfectn req.) Includes HRHeLa cell line control (250ug DNA)

Sign In for Pricing
View Details
FAM103A1 Lentiviral Activation Particles (h2)
sc-418204-LAC-2 200 µL

FAM103A1 Lentiviral Activation Particles (h2)

Sign In for Pricing
View Details
RPS6KC1 Antibody
47944 100 µL

RPS6KC1 Antibody

Sign In for Pricing
View Details