Recombinant Human Nuclear mitotic apparatus protein 1 (NUMA1), partial, Biotinylated
This Recombinant Human Nuclear mitotic apparatus protein 1 (NUMA1), partial, Biotinylated spans the amino acid sequence from region 1-153. Purity: Greater than 85% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
Nuclear mitotic apparatus protein 1; Nuclear matrix protein-22; NMP-22; Nuclear mitotic apparatus protein; NuMA protein; SP-H antigen; NUMA1 NMP22 NUMA
UniProt
Q14980
Expression Region
1-153
Origin
Homo sapiens (Human)
Endotoxin
Not test
Purity
Greater than 85% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Storage Conditions
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
AA Sequence
MTLHATRGAALLSWVNSLHVADPVEAVLQLQDCSIFIKIIDRIHGTEEGQQILKQPVSERLDFVCSFLQKNRKHPSSPECLVSAQKVLEGSELELAKMTMLLLYHSTMSSKSPRDWEQFEYKIQAELAVILKFVLDHEDGLNLNEDLENFLQK
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
TL307348V 500 µL Each
SELO (SELENOO) Human shRNA Lentiviral Particle (Locus ID 83642)
Sign In for Pricing
View Details 
