Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Protein MGARP (HUMMR), partial, Biotinylated

This Recombinant Human Protein MGARP (HUMMR), partial, Biotinylated spans the amino acid sequence from region 1-40. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Protein MGARP; Corneal endothelium-specific protein 1; CESP-1; Hypoxia up-regulated mitochondrial movement regulator protein; Mitochondria-localized glutamic acid-rich protein; Ovary-specific acidic protein; MGARP C4orf49 CESP1 HUMMR OSAP GS3582

UniProt

Q8TDB4

Expression Region

1-40

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MYLRRAVSKTLALPLRAPPNPAPLGKDASLRRMSSNRFPG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse dentin sialophosphoProtein, DSPP GENLISA ELISA
KLM2001 1x 96 Well

Mouse dentin sialophosphoProtein, DSPP GENLISA ELISA

Sign In for Pricing
View Details
pCMV-SPORT6-PIK3AP1 Plasmid
PVT16472 2 µg

pCMV-SPORT6-PIK3AP1 Plasmid

Sign In for Pricing
View Details
Chrysophanol-8-O-beta-D- (6'-O-galloyl) -glucopyranoside
orb3159568 5 mg

Chrysophanol-8-O-beta-D- (6'-O-galloyl) -glucopyranoside

Sign In for Pricing
View Details
SMARCA5 Antibody
GWB-MM746H 50 µg

SMARCA5 Antibody

Sign In for Pricing
View Details
Rat Apolipoprotein H, APOH ELISA KIT
E0746Ra-01 48 Well

Rat Apolipoprotein H, APOH ELISA KIT

Sign In for Pricing
View Details
Rat Apolipoprotein H, APOH ELISA KIT
E0746Ra-02 96 Well

Rat Apolipoprotein H, APOH ELISA KIT

Sign In for Pricing
View Details