Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Selenoprotein S (SELS), partial, Biotinylated

This Recombinant Human Selenoprotein S (SELS), partial, Biotinylated spans the amino acid sequence from region 49-189. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Selenoprotein S; SelS; VCP-interacting membrane protein; SELENOS SELS VIMP AD-015 SBBI8

UniProt

Q9BQE4

Expression Region

49-189

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QKLSARLRALRQRQLDRAAAAVEPDVVVKRQEALAAARLKMQEELNAQVEKHKEKLKQLEEEKRRQKIEMWDSMQEGKSYKGNAKKPQEEDSPGPSTSSVLKRKSDRKPLRGGGYNPLSGEGGGACSWRPGRRGPSSGGUG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PEA-15 (Ab-116) Antibody
8B0545-AAT 50 µg

PEA-15 (Ab-116) Antibody

Sign In for Pricing
View Details
FOLH1 / PSMA (Prostate Epithelial Marker) (FOLH1/3149R), CF640R conjugate, 0.1mg/mL
BNC403149-100 1x 100 µL

FOLH1 / PSMA (Prostate Epithelial Marker) (FOLH1/3149R), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Frozen Tissue Sections, Lung
CS504137 5x 5 µm

Frozen Tissue Sections, Lung

Sign In for Pricing
View Details
GAS1 Human Gene Knockout Kit (CRISPR)
KN224804BN 1 Kit

GAS1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
GPX4 Rabbit Polyclonal Antibody
ER1803-15 100 µL

GPX4 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
RAD51 (Prognostic and Response to Chemotherapy Marker) (RAD51/2702), CF488A conjugate, 0.1mg/mL
BNC882702-100 1x 100 µL

RAD51 (Prognostic and Response to Chemotherapy Marker) (RAD51/2702), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details