Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Selenoprotein S (SELS), partial, Biotinylated

This Recombinant Human Selenoprotein S (SELS), partial, Biotinylated spans the amino acid sequence from region 49-189. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Selenoprotein S; SelS; VCP-interacting membrane protein; SELENOS SELS VIMP AD-015 SBBI8

UniProt

Q9BQE4

Expression Region

49-189

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QKLSARLRALRQRQLDRAAAAVEPDVVVKRQEALAAARLKMQEELNAQVEKHKEKLKQLEEEKRRQKIEMWDSMQEGKSYKGNAKKPQEEDSPGPSTSSVLKRKSDRKPLRGGGYNPLSGEGGGACSWRPGRRGPSSGGUG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD22 / BL-CAM (B-Cell Marker) (RFB4), CF740 conjugate, 0.1mg/mL
BNC741594-500 1x 500 µL

CD22 / BL-CAM (B-Cell Marker) (RFB4), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Furaptra, AM Ester, 10x100ug
#50037 10x 100 µg

Furaptra, AM Ester, 10x100ug

Sign In for Pricing
View Details
Human Angiopoietin like 4 (ANGPTL4) activation kit by CRISPRa
GA109591 1 Kit

Human Angiopoietin like 4 (ANGPTL4) activation kit by CRISPRa

Sign In for Pricing
View Details
Human RBM48 activation kit by CRISPRa
GA113344 1 Kit

Human RBM48 activation kit by CRISPRa

Sign In for Pricing
View Details
CHST8 (NM_001127895) Human Over-expression Lysate
LY426881 100 µg

CHST8 (NM_001127895) Human Over-expression Lysate

Sign In for Pricing
View Details
MUC1 / CA15-3 / EMA / CD227 (Epithelial Marker) (MUC1/2818R), CF405S conjugate, 0.1mg/mL
BNC042818-500 1x 500 µL

MUC1 / CA15-3 / EMA / CD227 (Epithelial Marker) (MUC1/2818R), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details