Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Selenoprotein S (SELS), partial, Biotinylated

This Recombinant Human Selenoprotein S (SELS), partial, Biotinylated spans the amino acid sequence from region 49-189. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Selenoprotein S; SelS; VCP-interacting membrane protein; SELENOS SELS VIMP AD-015 SBBI8

UniProt

Q9BQE4

Expression Region

49-189

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QKLSARLRALRQRQLDRAAAAVEPDVVVKRQEALAAARLKMQEELNAQVEKHKEKLKQLEEEKRRQKIEMWDSMQEGKSYKGNAKKPQEEDSPGPSTSSVLKRKSDRKPLRGGGYNPLSGEGGGACSWRPGRRGPSSGGUG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MIR8053 Human qPCR Primer Pair (MI0025889)
HP301558 200 Reactions

MIR8053 Human qPCR Primer Pair (MI0025889)

Sign In for Pricing
View Details
TJP1 Human Gene Knockout Kit (CRISPR)
KN216224LP 1 Kit

TJP1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Tissue FFPE Sections, Stomach
CS710951 5x 5 µm

Tissue FFPE Sections, Stomach

Sign In for Pricing
View Details
Phosphotyrosine (P-Tyr) (PY265), CF568 conjugate, 0.1mg/mL
BNC680265-500 1x 500 µL

Phosphotyrosine (P-Tyr) (PY265), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
ADCY1 Polyclonal Antibody
E-AB-16138-01 20 µL

ADCY1 Polyclonal Antibody

Sign In for Pricing
View Details
ADCY1 Polyclonal Antibody
E-AB-16138-02 60 µL

ADCY1 Polyclonal Antibody

Sign In for Pricing
View Details