Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Selenoprotein S (SELS), partial, Biotinylated

This Recombinant Human Selenoprotein S (SELS), partial, Biotinylated spans the amino acid sequence from region 49-189. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Selenoprotein S; SelS; VCP-interacting membrane protein; SELENOS SELS VIMP AD-015 SBBI8

UniProt

Q9BQE4

Expression Region

49-189

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QKLSARLRALRQRQLDRAAAAVEPDVVVKRQEALAAARLKMQEELNAQVEKHKEKLKQLEEEKRRQKIEMWDSMQEGKSYKGNAKKPQEEDSPGPSTSSVLKRKSDRKPLRGGGYNPLSGEGGGACSWRPGRRGPSSGGUG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Complement C9 (C9) (NM_001737) Human Over-expression Lysate
LC419774 20 µg

Complement C9 (C9) (NM_001737) Human Over-expression Lysate

Sign In for Pricing
View Details
Human Troponin T Type 2, Cardiac (TNNT2) ELISA Kit
RD-TNNT2-Hu-01 96 Tests

Human Troponin T Type 2, Cardiac (TNNT2) ELISA Kit

Sign In for Pricing
View Details
Human Troponin T Type 2, Cardiac (TNNT2) ELISA Kit
RD-TNNT2-Hu-02 48 Tests

Human Troponin T Type 2, Cardiac (TNNT2) ELISA Kit

Sign In for Pricing
View Details
Nuclear Factor 1 (NFIA) (NM_001134673) Human Recombinant Protein
TP325878 20 µg

Nuclear Factor 1 (NFIA) (NM_001134673) Human Recombinant Protein

Sign In for Pricing
View Details
6-Hydroxy-2-naphthaleneacetic Acid
TRC-H948520-250MG 250 mg

6-Hydroxy-2-naphthaleneacetic Acid

Sign In for Pricing
View Details
Frozen Tissue Sections, Lung
CS506234 5x 5 µm

Frozen Tissue Sections, Lung

Sign In for Pricing
View Details