Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Synaptotagmin-3 (SYT3), partial, Biotinylated

This Recombinant Human Synaptotagmin-3 (SYT3), partial, Biotinylated spans the amino acid sequence from region 76-590. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Synaptotagmin-3; Synaptotagmin III; SytIII; SYT3

UniProt

Q9BQG1

Expression Region

76-590

Origin

Homo sapiens (Human)

Field of Research

Stem Cell & Developmental Biology

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

WKLCWVPWRDKGGSAVGGGPLRKDLGPGVGLAGLVGGGGHHLAAGLGGHPLLGGPHHHAHAAHHPPFAELLEPGSLGGSDTPEPSYLDMDSYPEAAAAAVAAGVKPSQTSPELPSEGGAGSGLLLLPPSGGGLPSAQSHQQVTSLAPTTRYPALPRPLTQQTLTSQPDPSSEERPPALPLPLPGGEEKAKLIGQIKPELYQGTGPGGRRSGGGPGSGEAGTGAPCGRISFALRYLYGSDQLVVRILQALDLPAKDSNGFSDPYVKIYLLPDRKKKFQTKVHRKTLNPVFNETFQFSVPLAELAQRKLHFSVYDFDRFSRHDLIGQVVLDNLLELAEQPPDRPLWRDIVEGGSEKADLGELNFSLCYLPTAGRLTVTIIKASNLKAMDLTGFSDPYVKASLISEGRRLKKRKTSIKKNTLNPTYNEALVFDVAPESVENVGLSIAVVDYDCIGHNEVIGVCRVGPDAADPHGREHWAEMLANPRKPVEHWHQLVEEKTVTSFTKGSKGLSEKENSE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Selegiline hydrochloride
B3419-50 50 mg

Selegiline hydrochloride

Sign In for Pricing
View Details
IL9R Mouse Monoclonal Antibody [Clone ID: AH9R7]
AM26785PU-N 100 µg

IL9R Mouse Monoclonal Antibody [Clone ID: AH9R7]

Sign In for Pricing
View Details
ATP5G1P8 Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a)
LV719350 1.0 µg DNA

ATP5G1P8 Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a)

Sign In for Pricing
View Details
LYVE1 Antibody (Biotin)
orb52321-01 50 µg

LYVE1 Antibody (Biotin)

Sign In for Pricing
View Details
LYVE1 Antibody (Biotin)
orb52321-02 100 µg

LYVE1 Antibody (Biotin)

Sign In for Pricing
View Details
(R, S) 2-Hydroxy-3- (3-pyridyl) propionic acid ≥95% (HPLC)
241500-01 100 mg

(R, S) 2-Hydroxy-3- (3-pyridyl) propionic acid ≥95% (HPLC)

Sign In for Pricing
View Details