Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Allograft inflammatory factor 1-like (AIF1L), Biotinylated

This Recombinant Human Allograft inflammatory factor 1-like (AIF1L), Biotinylated spans the amino acid sequence from region 2-150. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Allograft inflammatory factor 1-like; Ionized calcium-binding adapter molecule 2; AIF1L C9orf58 IBA2 UNQ672/PRO1306

UniProt

Q9BQI0

Expression Region

2-150

Origin

Homo sapiens (Human)

Field of Research

Musculoskeletal & Connective Tissue Research

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

SGELSNRFQGGKAFGLLKARQERRLAEINREFLCDQKYSDEENLPEKLTAFKEKYMEFDLNNEGEIDLMSLKRMMEKLGVPKTHLEMKKMISEVTGGVSDTISYRDFVNMMLGKRSAVLKLVMMFEGKANESSPKPVGPPPERDIASLP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Gata5 activation kit by CRISPRa
GA201555 1 Kit

Mouse Gata5 activation kit by CRISPRa

Sign In for Pricing
View Details
Calreticulin (CALR) Rabbit Polyclonal Antibody
AP33519PU-N 400 µL

Calreticulin (CALR) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CD95 / FAS / TNFRSF6 (FAS/3588), Biotin conjugate, 0.1mg/mL
BNCB3588-500 1x 500 µL

CD95 / FAS / TNFRSF6 (FAS/3588), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
1,2-Dilinoleoyl-3-tert-butyldiphenylsilyl Glycerol-d5
TRC-D185007-5MG 5 mg

1,2-Dilinoleoyl-3-tert-butyldiphenylsilyl Glycerol-d5

Sign In for Pricing
View Details
Tissue Total RNA, Uterus
CR560203 5 µg

Tissue Total RNA, Uterus

Sign In for Pricing
View Details
GI24 (C10orf54) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI7A6D5]
TA812257AM 100 µL

GI24 (C10orf54) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI7A6D5]

Sign In for Pricing
View Details