Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Allograft inflammatory factor 1-like (AIF1L), Biotinylated

This Recombinant Human Allograft inflammatory factor 1-like (AIF1L), Biotinylated spans the amino acid sequence from region 2-150. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Allograft inflammatory factor 1-like; Ionized calcium-binding adapter molecule 2; AIF1L C9orf58 IBA2 UNQ672/PRO1306

UniProt

Q9BQI0

Expression Region

2-150

Origin

Homo sapiens (Human)

Field of Research

Musculoskeletal & Connective Tissue Research

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

SGELSNRFQGGKAFGLLKARQERRLAEINREFLCDQKYSDEENLPEKLTAFKEKYMEFDLNNEGEIDLMSLKRMMEKLGVPKTHLEMKKMISEVTGGVSDTISYRDFVNMMLGKRSAVLKLVMMFEGKANESSPKPVGPPPERDIASLP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Tyrosine hydroxylase (TH) ELISA Kit
AE17257MO-01 48 Tests

Mouse Tyrosine hydroxylase (TH) ELISA Kit

Sign In for Pricing
View Details
Mouse Tyrosine hydroxylase (TH) ELISA Kit
AE17257MO-02 96 Tests

Mouse Tyrosine hydroxylase (TH) ELISA Kit

Sign In for Pricing
View Details
CCS siRNA Oligos set (Human)
15439171 3x 5 nmol

CCS siRNA Oligos set (Human)

Sign In for Pricing
View Details
VTA1 Antibody
orb357535-01 50 µg

VTA1 Antibody

Sign In for Pricing
View Details
VTA1 Antibody
orb357535-02 100 µg

VTA1 Antibody

Sign In for Pricing
View Details
Angiotensin Converting Enzyme 2 (CT) (ACE 2, ACE2, ACE-2, ACE-related Carboxypeptidase, Angiotensin Converting Enzyme Homolog, ACEH, Angiotensin Converting Enzyme-like Protein, Angiotensin I Converting Enzyme (Peptidyl Dipeptidase A) 2, Angiotensin I Converting Enzyme 2, DKFZP434A014, EC 3.4.17, OTTHUMP00000022963) (APC)
A2295-02R3-APC 100 µL

Angiotensin Converting Enzyme 2 (CT) (ACE 2, ACE2, ACE-2, ACE-related Carboxypeptidase, Angiotensin Converting Enzyme Homolog, ACEH, Angiotensin Converting Enzyme-like Protein, Angiotensin I Converting Enzyme (Peptidyl Dipeptidase A) 2, Angiotensin I Converting Enzyme 2, DKFZP434A014, EC 3.4.17, OTTHUMP00000022963) (APC)

Sign In for Pricing
View Details