Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Protein jagged-2 (JAG2), partial, Biotinylated

This Recombinant Human Protein jagged-2 (JAG2), partial, Biotinylated spans the amino acid sequence from region 870-944. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Protein jagged-2; Jagged2; hJ2; JAG2

UniProt

Q9Y219

Expression Region

870-944

Origin

Homo sapiens (Human)

Field of Research

Stem Cell & Developmental Biology

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

RSCWSRGTPFPHGSSWVEDCNSCRCLDGRRDCSKVWCGWKPCLLAGQPEALSAQCPLGQRCLEKAPGQCLRPPCE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ppard siRNA Oligos set (Rat)
37297176 3x 5 nmol

Ppard siRNA Oligos set (Rat)

Sign In for Pricing
View Details
SNORA38B sgRNA CRISPR Lentivector (Human) (Target 2)
K2216503 1.0 µg DNA

SNORA38B sgRNA CRISPR Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
(±) -trans-4- (2-Naphthyl) pyrrolidine-3-carboxylic acid hydrochloride
285865-01 50 mg

(±) -trans-4- (2-Naphthyl) pyrrolidine-3-carboxylic acid hydrochloride

Sign In for Pricing
View Details
(±) -trans-4- (2-Naphthyl) pyrrolidine-3-carboxylic acid hydrochloride
285865-02 100 mg

(±) -trans-4- (2-Naphthyl) pyrrolidine-3-carboxylic acid hydrochloride

Sign In for Pricing
View Details
(±) -trans-4- (2-Naphthyl) pyrrolidine-3-carboxylic acid hydrochloride
285865-03 250 mg

(±) -trans-4- (2-Naphthyl) pyrrolidine-3-carboxylic acid hydrochloride

Sign In for Pricing
View Details
(±) -trans-4- (2-Naphthyl) pyrrolidine-3-carboxylic acid hydrochloride
285865-04 500 mg

(±) -trans-4- (2-Naphthyl) pyrrolidine-3-carboxylic acid hydrochloride

Sign In for Pricing
View Details