Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Sodium-dependent multivitamin transporter (SC5A6), partial, Biotinylated

This Recombinant Human Sodium-dependent multivitamin transporter (SC5A6), partial, Biotinylated spans the amino acid sequence from region 549-635. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Sodium-dependent multivitamin transporter; Na (+-dependent multivitamin transporter; hSMVT; Solute carrier family 5 member 6; SLC5A6 SMVT

UniProt

Q9Y289

Expression Region

549-635

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

TGRMRGRSLNPATIYPVLPKLLSLLPLSCQKRLHCRSYGQDHLDTGLFPEKPRNGVLGDSRDKEAMALDGTAYQGSSSTCILQETSL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PLAC8L1 Mouse Monoclonal Antibody [Clone ID: OTI8H8]
CF811566 100 µg

PLAC8L1 Mouse Monoclonal Antibody [Clone ID: OTI8H8]

Sign In for Pricing
View Details
5,6-Diamino-2-thiouracil Hydrochloride Salt (80%)
TRC-D416815-250MG 250 mg

5,6-Diamino-2-thiouracil Hydrochloride Salt (80%)

Sign In for Pricing
View Details
Calponin-1 (Smooth Muscle Marker), CF640R conjugate, 0.1mg/mL
BNC401685-100 1x 100 µL

Calponin-1 (Smooth Muscle Marker), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Semi Automatic Microtome BHTP-202
BHTP-202 1 Unit

Semi Automatic Microtome BHTP-202

Sign In for Pricing
View Details
MAGEF1 (NM_022149) Human Recombinant Protein
TP304018M 100 µg

MAGEF1 (NM_022149) Human Recombinant Protein

Sign In for Pricing
View Details
TMEM98 Human Gene Knockout Kit (CRISPR)
KN401829 1 Kit

TMEM98 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details