Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human E3 ubiquitin-protein ligase DTX4 (DTX4), Biotinylated

This Recombinant Human E3 ubiquitin-protein ligase DTX4 (DTX4), Biotinylated spans the amino acid sequence from region 1-619. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

E3 ubiquitin-protein ligase DTX4; EC 2.3.2.27; Protein deltex-4; Deltex4; RING finger protein 155; RING-type E3 ubiquitin transferase DTX4; DTX4 KIAA0937 RNF155

UniProt

Q9Y2E6

Expression Region

1-619

Origin

Homo sapiens (Human)

Field of Research

Molecular Biology

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MLLASAVVVWEWLNEHGRWRPYSPAVSHHIEAVVRAGPRAGGSVVLGQVDSRLAPYIIDLQSMNQFRQDTGTLRPVRRNYYDPSSAPGKGVVWEWENDNGSWTPYDMEVGITIQHAYEKQHPWIDLTSIGFSYVIDFNTMGQINRQTQRQRRVRRRLDLIYPMVTGTLPKAQSWPVSPGPATSPPMSPCSCPQCVLVMSVKAAVVNGSTGPLQLPVTRKNMPPPGVVKLPPLPGSGAKPLDSTGTIRGPLKTAPSQVIRRQASSMPTGTTMGSPASPPGPNSKTGRVALATLNRTNLQRLAIAQSRVLIASGVPTVPVKNLNGSSPVNPALAGITGILMSAAGLPVCLTRPPKLVLHPPPVSKSEIKSIPGVSNTSRKTTKKQAKKGKTPEEVLKKYLQKVRHPPDEDCTICMERLTAPSGYKGPQPTVKPDLVGKLSRCGHVYHIYCLVAMYNNGNKDGSLQCPTCKTIYGVKTGTQPPGKMEYHLIPHSLPGHPDCKTIRIIYSIPPGIQGPEHPNPGKSFSARGFPRHCYLPDSEKGRKVLKLLLVAWDRRLIFAIGTSSTTGESDTVIWNEVHHKTEFGSNLTGHGYPDANYLDNVLAELAAQGISEDSTAQEKD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TRMT2A Polyclonal Antibody
MBS2548216-01 0.06 mL

TRMT2A Polyclonal Antibody

Sign In for Pricing
View Details
TRMT2A Polyclonal Antibody
MBS2548216-02 0.12 mL

TRMT2A Polyclonal Antibody

Sign In for Pricing
View Details
TRMT2A Polyclonal Antibody
MBS2548216-03 0.2 mL

TRMT2A Polyclonal Antibody

Sign In for Pricing
View Details
TRMT2A Polyclonal Antibody
MBS2548216-04 5x 0.2 mL

TRMT2A Polyclonal Antibody

Sign In for Pricing
View Details
Histone cluster 1 H4H shRNA Plasmid (h)
sc-105501-SH 20 µg

Histone cluster 1 H4H shRNA Plasmid (h)

Sign In for Pricing
View Details
2,2-Dichloro-1- (4-methoxyphenyl) ethanol
OR1095884-01 1 g

2,2-Dichloro-1- (4-methoxyphenyl) ethanol

Sign In for Pricing
View Details