Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Sodium/hydrogen exchanger 8 (SL9A8), partial, Biotinylated

This Recombinant Human Sodium/hydrogen exchanger 8 (SL9A8), partial, Biotinylated spans the amino acid sequence from region 472-581. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Sodium/hydrogen exchanger 8; Na (+/H (+; exchanger 8; NHE-8; Solute carrier family 9 member 8; SLC9A8 KIAA0939 NHE8

UniProt

Q9Y2E8

Expression Region

472-581

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

RLMDIEDAKAHRRNKKDVNLSKTEKMGNTVESEHLSELTEEEYEAHYIRRQDLKGFVWLDAKYLNPFFTRRLTQEDLHHGRIQMKTLTNKWYEEVRQGPSGSEDDEQELL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IMPDH1 (NM_183243) Human Recombinant Protein
TP307118 20 µg

IMPDH1 (NM_183243) Human Recombinant Protein

Sign In for Pricing
View Details
9030612E09Rik Mouse Gene Knockout Kit (CRISPR)
KN500502 1 Kit

9030612E09Rik Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Horizontal Autoclave BAHZ-801-E
BAHZ-801-E 1 Unit

Horizontal Autoclave BAHZ-801-E

Sign In for Pricing
View Details
Benzoestrol
TRC-B203550-5MG 5 mg

Benzoestrol

Sign In for Pricing
View Details
Emerin Recombinant Rabbit Monoclonal Antibody [PSH01-86]
HA721744 100 µL

Emerin Recombinant Rabbit Monoclonal Antibody [PSH01-86]

Sign In for Pricing
View Details
25mm stainless steel grinding ball, each
IPD9600-25BS 1 Each

25mm stainless steel grinding ball, each

Sign In for Pricing
View Details