Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Sodium/hydrogen exchanger 8 (SL9A8), partial, Biotinylated

This Recombinant Human Sodium/hydrogen exchanger 8 (SL9A8), partial, Biotinylated spans the amino acid sequence from region 472-581. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Sodium/hydrogen exchanger 8; Na (+/H (+; exchanger 8; NHE-8; Solute carrier family 9 member 8; SLC9A8 KIAA0939 NHE8

UniProt

Q9Y2E8

Expression Region

472-581

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

RLMDIEDAKAHRRNKKDVNLSKTEKMGNTVESEHLSELTEEEYEAHYIRRQDLKGFVWLDAKYLNPFFTRRLTQEDLHHGRIQMKTLTNKWYEEVRQGPSGSEDDEQELL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RIPX (RUFY3) (NM_014961) Human Recombinant Protein
TP307961M 100 µg

RIPX (RUFY3) (NM_014961) Human Recombinant Protein

Sign In for Pricing
View Details
HER-2 / c-erbB-2 / neu / CD340 (ERBB2/2452), CF647 conjugate, 0.1mg/mL
BNC472452-100 1x 100 µL

HER-2 / c-erbB-2 / neu / CD340 (ERBB2/2452), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Frizzled 9 (FZD9) Rabbit Monoclonal Antibody
TA423771 100 µL

Frizzled 9 (FZD9) Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
Human LRRC30 activation kit by CRISPRa
GA117412 1 Kit

Human LRRC30 activation kit by CRISPRa

Sign In for Pricing
View Details
MBD4 Rabbit Polyclonal Antibody
TA361260 100 µL

MBD4 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Glycitin
TRC-G635410-2.5MG 2.5 mg

Glycitin

Sign In for Pricing
View Details