Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Fanconi-associated nuclease 1 (FAN1), partial, Biotinylated

This Recombinant Human Fanconi-associated nuclease 1 (FAN1), partial, Biotinylated spans the amino acid sequence from region 895-1007. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Fanconi-associated nuclease 1; EC 3.1.21.-; EC 3.1.4.1; FANCD2/FANCI-associated nuclease 1; hFAN1; Myotubularin-related protein 15; FAN1 KIAA1018 MTMR15

UniProt

Q9Y2M0

Expression Region

895-1007

Origin

Homo sapiens (Human)

Field of Research

Epigenetics & Chromatin

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

EESLRAWVAATWHEQEGRVASLVSWDRFTSLQQAQDLVSCLGGPVLSGVCRHLAADFRHCRGGLPDLVVWNSQSRHFKLVEVKGPNDRLSHKQMIWLAELQKLGAEVEVCHVV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD45 / LCA (2B11 + PD7/26), CF740 conjugate, 0.1mg/mL
BNC740745-100 1x 100 µL

CD45 / LCA (2B11 + PD7/26), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD3e (CRIS-7), CF543 conjugate, 0.1mg/mL
BNC431050-500 1x 500 µL

CD3e (CRIS-7), CF543 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD11c (HC1/1), CF488A conjugate, 0.1mg/mL
BNC880152-100 1x 100 µL

CD11c (HC1/1), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD104 (UM-A9), CF640R conjugate, 0.1mg/mL
BNC400449-500 1x 500 µL

CD104 (UM-A9), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD35 / CR1 (CR1/802), CF647 conjugate, 0.1mg/mL
BNC470802-500 1x 500 µL

CD35 / CR1 (CR1/802), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details