Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Fanconi-associated nuclease 1 (FAN1), partial, Biotinylated

This Recombinant Human Fanconi-associated nuclease 1 (FAN1), partial, Biotinylated spans the amino acid sequence from region 895-1007. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Fanconi-associated nuclease 1; EC 3.1.21.-; EC 3.1.4.1; FANCD2/FANCI-associated nuclease 1; hFAN1; Myotubularin-related protein 15; FAN1 KIAA1018 MTMR15

UniProt

Q9Y2M0

Expression Region

895-1007

Origin

Homo sapiens (Human)

Field of Research

Epigenetics & Chromatin

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

EESLRAWVAATWHEQEGRVASLVSWDRFTSLQQAQDLVSCLGGPVLSGVCRHLAADFRHCRGGLPDLVVWNSQSRHFKLVEVKGPNDRLSHKQMIWLAELQKLGAEVEVCHVV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Nephrin-Rluc (Bsd) Lentivirus
LVP1107-B 1x 10^7 IFU/mL - 200 μL

Nephrin-Rluc (Bsd) Lentivirus

Sign In for Pricing
View Details
Vegfa ORF Vector (Rat) (pORF)
ORF078787 1.0 µg DNA

Vegfa ORF Vector (Rat) (pORF)

Sign In for Pricing
View Details
COX5A (Cytochrome c Oxidase Subunit 5A, Mitochondrial, Cytochrome c Oxidase Polypeptide Va, COX5a, COX-5A) discontinued
221845-01 50 µL

COX5A (Cytochrome c Oxidase Subunit 5A, Mitochondrial, Cytochrome c Oxidase Polypeptide Va, COX5a, COX-5A) discontinued

Sign In for Pricing
View Details
COX5A (Cytochrome c Oxidase Subunit 5A, Mitochondrial, Cytochrome c Oxidase Polypeptide Va, COX5a, COX-5A) discontinued
221845-02 100 µL

COX5A (Cytochrome c Oxidase Subunit 5A, Mitochondrial, Cytochrome c Oxidase Polypeptide Va, COX5a, COX-5A) discontinued

Sign In for Pricing
View Details
Mouse Monoclonal PPIL6 Antibody (OTI4F2) - Azide and BSA Free
NBP2-73578 100 µg

Mouse Monoclonal PPIL6 Antibody (OTI4F2) - Azide and BSA Free

Sign In for Pricing
View Details
LILRA5/CD85f Rabbit pAb, AE conjugated
orb2873967 100 µL

LILRA5/CD85f Rabbit pAb, AE conjugated

Sign In for Pricing
View Details