Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Peptidyl-tRNA hydrolase 2, mitochondrial (PTH2), partial, Biotinylated

This Recombinant Human Peptidyl-tRNA hydrolase 2, mitochondrial (PTH2), partial, Biotinylated spans the amino acid sequence from region 38-179. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Peptidyl-tRNA hydrolase 2, mitochondrial; PTH 2; EC 3.1.1.29; Bcl-2 inhibitor of transcription 1; PTRH2 BIT1 PTH2 CGI-147

UniProt

Q9Y3E5

Expression Region

38-179

Origin

Homo sapiens (Human)

Field of Research

Neuroscience

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

GMLPKSKTSKTHTDTESEASILGDSGEYKMILVVRNDLKMGKGKVAAQCSHAAVSAYKQIQRRNPEMLKQWEYCGQPKVVVKAPDEETLIALLAHAKMLGLTVSLIQDAGRTQIAPGSQTVLGIGPGPADLIDKVTGHLKLY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MMP8 Rabbit pAb
E2501963 100 µL

MMP8 Rabbit pAb

Sign In for Pricing
View Details
Goat Anti-Rabbit IgG (H&L) Antibody (Polyclonal IgG) - Cy5
20330199-1 1 mg

Goat Anti-Rabbit IgG (H&L) Antibody (Polyclonal IgG) - Cy5

Sign In for Pricing
View Details
PDE2A (NM_001143839) Human Tagged ORF Clone Lentiviral Particle
RC226806L3V 200 µL

PDE2A (NM_001143839) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
AAK1 CRISPRa sgRNA lentivector (set of three targets)(Mouse)
10992124 3x 1.0µg DNA

AAK1 CRISPRa sgRNA lentivector (set of three targets)(Mouse)

Sign In for Pricing
View Details
Boc- (R) -3-Amino-3- (2-furyl) -propionic acid
CSB-DT4051 1 g

Boc- (R) -3-Amino-3- (2-furyl) -propionic acid

Sign In for Pricing
View Details
Rabbit Anti Human TH Monoclonal Clone ECA-20 100UL
IRBAHUTHECA20C100UL 100 µL

Rabbit Anti Human TH Monoclonal Clone ECA-20 100UL

Sign In for Pricing
View Details