Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Carboxypeptidase Q (CBPQ), Biotinylated

This Recombinant Human Carboxypeptidase Q (CBPQ), Biotinylated spans the amino acid sequence from region 45-472. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Carboxypeptidase Q; EC 3.4.17.-; Lysosomal dipeptidase; Plasma glutamate carboxypeptidase; CPQ LCH1 PGCP

UniProt

Q9Y646

Expression Region

45-472

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

DVAKAIINLAVYGKAQNRSYERLALLVDTVGPRLSGSKNLEKAIQIMYQNLQQDGLEKVHLEPVRIPHWERGEESAVMLEPRIHKIAILGLGSSIGTPPEGITAEVLVVTSFDELQRRASEARGKIVVYNQPYINYSRTVQYRTQGAVEAAKVGALASLIRSVASFSIYSPHTGIQEYQDGVPKIPTACITVEDAEMMSRMASHGIKIVIQLKMGAKTYPDTDSFNTVAEITGSKYPEQVVLVSGHLDSWDVGQGAMDDGGGAFISWEALSLIKDLGLRPKRTLRLVLWTAEEQGGVGAFQYYQLHKVNISNYSLVMESDAGTFLPTGLQFTGSEKARAIMEEVMSLLQPLNITQVLSHGEGTDINFWIQAGVPGASLLDDLYKYFFFHHSHGDTMTVMDPKQMNVAAAVWAVVSYVVADMEEMLPRS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human SPG11 Pre-designed siRNA Set A
SI015643A 1 Each

Human SPG11 Pre-designed siRNA Set A

Sign In for Pricing
View Details
Phospho-EGFR-Y1197 Rabbit pAb
E45R30179N 50 ul

Phospho-EGFR-Y1197 Rabbit pAb

Sign In for Pricing
View Details
TNF alpha (TNF) (NM_000594) Human Tagged ORF Clone Lentiviral Particle
RC206983L1V 200 µL

TNF alpha (TNF) (NM_000594) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Chemerin, aa29-67, Human (TIG2)
301937 100 µg

Chemerin, aa29-67, Human (TIG2)

Sign In for Pricing
View Details
Human Heat Shock 70kDa Protein 1B (HSPA1B) ELISA Kit
QY-E01780 96 Tests

Human Heat Shock 70kDa Protein 1B (HSPA1B) ELISA Kit

Sign In for Pricing
View Details
RAB37 CRISPRa sgRNA lentivector (set of three targets)(Human)
38328121 3x 1.0µg DNA

RAB37 CRISPRa sgRNA lentivector (set of three targets)(Human)

Sign In for Pricing
View Details