Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Probable RNA-binding protein 19 (RBM19), partial, Biotinylated

This Recombinant Human Probable RNA-binding protein 19 (RBM19), partial, Biotinylated spans the amino acid sequence from region 730-811. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Probable RNA-binding protein 19; RNA-binding motif protein 19; RBM19 KIAA0682

UniProt

Q9Y4C8

Expression Region

730-811

Origin

Homo sapiens (Human)

Field of Research

Stem Cell & Developmental Biology

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

CTLFIKNLNFDTTEEKLKEVFSKVGTVKSCSISKKKNKAGVLLSMGFGFVEYRKPEQAQKALKQLQGHVVDGHKLEVRISER

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Gamma-Aminobutyric Acid B Receptor 1 (gABBR1) Magnetic Luminex Assay Kit
LKU602718 96 Tests

Gamma-Aminobutyric Acid B Receptor 1 (gABBR1) Magnetic Luminex Assay Kit

Sign In for Pricing
View Details
ENO1 Polyclonal Antibody, FITC Conjugated
A52698-050 50 µL

ENO1 Polyclonal Antibody, FITC Conjugated

Sign In for Pricing
View Details
Recombinant Arabidopsis thaliana Glutathione S-transferase U23 (GSTU23)
MBS1384887-01 0.02 mg (E-Coli)

Recombinant Arabidopsis thaliana Glutathione S-transferase U23 (GSTU23)

Sign In for Pricing
View Details
Recombinant Arabidopsis thaliana Glutathione S-transferase U23 (GSTU23)
MBS1384887-02 0.1 mg (E-Coli)

Recombinant Arabidopsis thaliana Glutathione S-transferase U23 (GSTU23)

Sign In for Pricing
View Details
Recombinant Arabidopsis thaliana Glutathione S-transferase U23 (GSTU23)
MBS1384887-03 0.02 mg (Yeast)

Recombinant Arabidopsis thaliana Glutathione S-transferase U23 (GSTU23)

Sign In for Pricing
View Details
Recombinant Arabidopsis thaliana Glutathione S-transferase U23 (GSTU23)
MBS1384887-04 0.1 mg (Yeast)

Recombinant Arabidopsis thaliana Glutathione S-transferase U23 (GSTU23)

Sign In for Pricing
View Details