Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Mitochondrial pyruvate carrier 1 (MPC1), partial, Biotinylated

This Recombinant Human Mitochondrial pyruvate carrier 1 (MPC1), partial, Biotinylated spans the amino acid sequence from region 72-109. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Mitochondrial pyruvate carrier 1; Brain protein 44-like protein; MPC1 BRP44L CGI-129 HSPC040 PNAS-115

UniProt

Q9Y5U8

Expression Region

72-109

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

KVQPRNWLLFACHATNEVAQLIQGGRLIKHEMTKTASA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD63 (Mouse) Recombinant Monoclonal Rat Antibody (24MS05.63), CF®568 Conjugate - Biotium Choice
P020-568-500 1x 500 µL

CD63 (Mouse) Recombinant Monoclonal Rat Antibody (24MS05.63), CF®568 Conjugate - Biotium Choice

Sign In for Pricing
View Details
Trypsin Activity Assay Kit
E-BC-K843-M-01 48 T (32 samples)

Trypsin Activity Assay Kit

Sign In for Pricing
View Details
Trypsin Activity Assay Kit
E-BC-K843-M-02 96 T (80 samples)

Trypsin Activity Assay Kit

Sign In for Pricing
View Details
PD-L1 / PDCD1LG1 / CD274 / B7-H1 (Cancer Immunotherapy Target) (PDL1/2741), CF568 conjugate, 0.1mg/mL
BNC682741-100 1x 100 µL

PD-L1 / PDCD1LG1 / CD274 / B7-H1 (Cancer Immunotherapy Target) (PDL1/2741), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Filamin A (FLNA) Rabbit Polyclonal Antibody
TA364803 100 µL

Filamin A (FLNA) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Cardiac Troponin I (TNNI3) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI3B4]
TA807935AM 100 µL

Cardiac Troponin I (TNNI3) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI3B4]

Sign In for Pricing
View Details