Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Mitochondrial pyruvate carrier 1 (MPC1), partial, Biotinylated

This Recombinant Human Mitochondrial pyruvate carrier 1 (MPC1), partial, Biotinylated spans the amino acid sequence from region 72-109. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Mitochondrial pyruvate carrier 1; Brain protein 44-like protein; MPC1 BRP44L CGI-129 HSPC040 PNAS-115

UniProt

Q9Y5U8

Expression Region

72-109

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

KVQPRNWLLFACHATNEVAQLIQGGRLIKHEMTKTASA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Slc12a3 (NM_019415) Mouse Tagged Lenti ORF Clone
MR211420L3 10 µg

Slc12a3 (NM_019415) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Lentiviral human TTLL9 sgRNA gene knockout kit - Lentiviral human TTLL9 sgRNA gene knockout kit (100)
GTR15360460 1 Vial

Lentiviral human TTLL9 sgRNA gene knockout kit - Lentiviral human TTLL9 sgRNA gene knockout kit (100)

Sign In for Pricing
View Details
ARMC9 Polyclonal Antibody, HRP Conjugated
A58161-100 100 µL

ARMC9 Polyclonal Antibody, HRP Conjugated

Sign In for Pricing
View Details
PAFAH1B3 Polyclonal Conjugated Antibody
C27868 100 µL

PAFAH1B3 Polyclonal Conjugated Antibody

Sign In for Pricing
View Details
Recombinant Synechococcus elongatus Photosystem II reaction center protein Z (psbZ)
orb2937487-01 20 µg

Recombinant Synechococcus elongatus Photosystem II reaction center protein Z (psbZ)

Sign In for Pricing
View Details
Recombinant Synechococcus elongatus Photosystem II reaction center protein Z (psbZ)
orb2937487-02 100 µg

Recombinant Synechococcus elongatus Photosystem II reaction center protein Z (psbZ)

Sign In for Pricing
View Details