Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Sorting nexin-14 (SNX14), partial, Biotinylated

This Recombinant Human Sorting nexin-14 (SNX14), partial, Biotinylated spans the amino acid sequence from region 130-304. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Sorting nexin-14 SNX14

UniProt

Q9Y5W7

Expression Region

130-304

Origin

Homo sapiens (Human)

Field of Research

Neuroscience

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

SSKVDASLSEVLELVLENFVYPWYRDVTDDESFVDELRITLRFFASVLIRRIHKVDIPSIITKKLLKAAMKHIEVIVKARQKVKNTEFLQQAALEEYGPELHVALRSRRDELHYLRKLTELLFPYILPPKATDCRSLTLLIREILSGSVFLPSLDFLADPDTVNHLLIIFIDDSP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PLCG 2 (PLCG2) Rabbit Polyclonal Antibody
AP08096PU-S 50 µL

PLCG 2 (PLCG2) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
OAS2 (NM_002535) Human Over-expression Lysate
LC400905 20 µg

OAS2 (NM_002535) Human Over-expression Lysate

Sign In for Pricing
View Details
2',3'-O-Isopropylidene-5-fluorouridine
TRC-I825100-1G 1 g

2',3'-O-Isopropylidene-5-fluorouridine

Sign In for Pricing
View Details
Annexin A1 / (Hairy Cell Leukemia Marker) (5E4/1), 0.2mg/mL
BNUB2325-500 1x 500 µL

Annexin A1 / (Hairy Cell Leukemia Marker) (5E4/1), 0.2mg/mL

Sign In for Pricing
View Details
MADM (NRBP1) Human Gene Knockout Kit (CRISPR)
KN400107 1 Kit

MADM (NRBP1) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Human C7orf61 activation kit by CRISPRa
GA118363 1 Kit

Human C7orf61 activation kit by CRISPRa

Sign In for Pricing
View Details