Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Sorting nexin-5 (SNX5), Biotinylated

This Recombinant Human Sorting nexin-5 (SNX5), Biotinylated spans the amino acid sequence from region 2-404. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Sorting nexin-5 SNX5

UniProt

Q9Y5X3

Expression Region

2-404

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

AAVPELLQQQEEDRSKLRSVSVDLNVDPSLQIDIPDALSERDKVKFTVHTKTTLPTFQSPEFSVTRQHEDFVWLHDTLIETTDYAGLIIPPAPTKPDFDGPREKMQKLGEGEGSMTKEEFAKMKQELEAEYLAVFKKTVSSHEVFLQRLSSHPVLSKDRNFHVFLEYDQDLSVRRKNTKEMFGGFFKSVVKSADEVLFTGVKEVDDFFEQEKNFLINYYNRIKDSCVKADKMTRSHKNVADDYIHTAACLHSLALEEPTVIKKYLLKVAELFEKLRKVEGRVSSDEDLKLTELLRYYMLNIEAAKDLLYRRTKALIDYENSNKALDKARLKSKDVKLAEAHQQECCQKFEQLSESAKEELINFKRKRVAAFRKNLIEMSELEIKHARNNVSLLQSCIDLFKNN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Bovine Blood Ketone Test Strips
YRAAD1001-001 50 Tests

Bovine Blood Ketone Test Strips

Sign In for Pricing
View Details
HDAC4 Rabbit pAb, FITC conjugated
orb2892015 100 µL

HDAC4 Rabbit pAb, FITC conjugated

Sign In for Pricing
View Details
3-Chloro-4,4'-difluoro-5-methoxy-1,1'-biphenyl
PC1019757-01 250 mg

3-Chloro-4,4'-difluoro-5-methoxy-1,1'-biphenyl

Sign In for Pricing
View Details
3-Chloro-4,4'-difluoro-5-methoxy-1,1'-biphenyl
PC1019757-02 500 mg

3-Chloro-4,4'-difluoro-5-methoxy-1,1'-biphenyl

Sign In for Pricing
View Details
POMT1 Antibody Blocking peptide
orb1458250 500 µg

POMT1 Antibody Blocking peptide

Sign In for Pricing
View Details
Recombinant Mycobacterium Abscessus rplO Protein (aa 1-146)
VAng-Yyj5551-50gEcoli 50 µg (E. coli)

Recombinant Mycobacterium Abscessus rplO Protein (aa 1-146)

Sign In for Pricing
View Details