Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human UbiA prenyltransferase domain-containing protein 1 (UBIA1), partial, Biotinylated

This Recombinant Human UbiA prenyltransferase domain-containing protein 1 (UBIA1), partial, Biotinylated spans the amino acid sequence from region 2-82. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

UbiA prenyltransferase domain-containing protein 1; EC 2.5.1.-; EC 2.5.1.39; Transitional epithelial response protein 1; UBIAD1 TERE1

UniProt

Q9Y5Z9

Expression Region

2-82

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

AASQVLGEKINILSGETVKAGDRDPLGNDCPEQDRLPQRSWRQKCASYVLALRPWSFSASLTPVALGSALAYRSHGVLDPR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-MEK1/MAP2K1 Antibody Picoband®, PE Conjugate
A00292-PE 100 µg/Vial

Anti-MEK1/MAP2K1 Antibody Picoband®, PE Conjugate

Sign In for Pricing
View Details
GG6L2 rabbit pAb
E28PT7581 100 µL

GG6L2 rabbit pAb

Sign In for Pricing
View Details
Leptin Sandwich ELISA Kit
EA101039 1 Kit

Leptin Sandwich ELISA Kit

Sign In for Pricing
View Details
Fucosyltransferase 10 alpha (1,3) (FUT10, FUC-TX, Alpha- (1,3) -fucosyltransferase 10, Galactoside 3-L-fucosyltransferase 10, FucT-X, MGC11141)
127014 100 µg

Fucosyltransferase 10 alpha (1,3) (FUT10, FUC-TX, Alpha- (1,3) -fucosyltransferase 10, Galactoside 3-L-fucosyltransferase 10, FucT-X, MGC11141)

Sign In for Pricing
View Details
Laminin Beta 2 Polyclonal Antibody, AbBy Fluor™ 350 Conjugated
bs-7504R-BF350 100 µL

Laminin Beta 2 Polyclonal Antibody, AbBy Fluor™ 350 Conjugated

Sign In for Pricing
View Details
Mouse Adenovirus antibody, IgG ELISA KIT
ED0055Mo-01 96 Well

Mouse Adenovirus antibody, IgG ELISA KIT

Sign In for Pricing
View Details