Recombinant Human Adhesion G-protein coupled receptor G1 (AGRG1), partial, Biotinylated

Adhesion G-protein coupled receptor G1; G-protein coupled receptor 56; [Cleaved into: Adhesion G-protein coupled receptor G1, N-terminal fragment; ADGRG1 N-terminal fragment; ADGRG1 NT; GPR56 N-terminal fragment; GPR56 NT; GPR56 (N; GPR56 extracellular subunit; GPR56 subunit alpha; Adhesion G-protein coupled receptor G1, C-terminal fragment; ADGRG1 C-terminal fragment; ADGRG1 CT; GPR56 C-terminal fragment; GPR56 CT; GPR56 (C; GPR56 seven-transmembrane subunit; GPR56 7TM; GPR56 subunit beta] ADGRG1 GPR56 TM7LN4 TM7XN1 UNQ540/PRO1083

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

RGHREDFRFCSQRNQTHRSSLHYKPTPDLRISIENSEEALTVHAPFPAAHPASRSFPDPRGLYHFCLYWNRHAGRLHLLYGKRDFLLSDKASSLLCFQHQEESLAQGPPLLATSVTSWWSPQNISLPSAASFTFSFHSPPHTAAHNASVDMCELKRDLQLLSQFLKHPQKASRRPSAAPASQQLQSLESKLTSVRFMGDMVSFEEDRINATVWKLQPTAGLQDLHIHSRQEEEQSEIMEYSVLLPRTLFQRTKGRSGEAEKRLLLVDFSSQALFQDKNSSQVLGEKVLGIVVQNTKVANLTEPVVLTFQHQLQPKNVTLQCVFWVEDPTLSSPGHWSSAGCETVRRETQTSCFCNHLTYFAVLMVSSVEVDAVHKH