Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Protein O-mannosyl-transferase 1 (POMT1), partial, Biotinylated

This Recombinant Human Protein O-mannosyl-transferase 1 (POMT1), partial, Biotinylated spans the amino acid sequence from region 290-596. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Protein O-mannosyl-transferase 1; EC 2.4.1.109; Dolichyl-phosphate-mannose--protein mannosyltransferase 1; POMT1

UniProt

Q9Y6A1

Expression Region

290-596

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

RSGPHDQIMSSAFQASLEGGLARITQGQPLEVAFGSQVTLRNVFGKPVPCWLHSHQDTYPMIYENGRGSSHQQQVTCYPFKDVNNWWIVKDPRRHQLVVSSPPRPVRHGDMVQLVHGMTTRSLNTHDVAAPLSPHSQEVSCYIDYNISMPAQNLWRLEIVNRGSDTDVWKTILSEVRFVHVNTSAVLKLSGAHLPDWGYRQLEIVGEKLSRGYHGSTVWNVEEHRYGASQEQRERERELHSPAQVDVSRNLSFMARFSELQWRMLALRSDDSEHKYSSSPLEWVTLDTNIAYWLHPRTSAQIHLLGN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SLC39A1 Protein Lysate
OCOA11138-20UG 20 µg

SLC39A1 Protein Lysate

Sign In for Pricing
View Details
FimC Antibody
orb814499 2 mg

FimC Antibody

Sign In for Pricing
View Details
Mouse Sptbn4 Pre-designed siRNA Set B
SI113788B 1 Each

Mouse Sptbn4 Pre-designed siRNA Set B

Sign In for Pricing
View Details
SH3TC1 Double Nickase Plasmid (m2)
sc-433042-NIC-2 20 µg

SH3TC1 Double Nickase Plasmid (m2)

Sign In for Pricing
View Details
Itopride Hydrochloride
TRC-I931500-100MG 100 mg

Itopride Hydrochloride

Sign In for Pricing
View Details
gasdermin Lentiviral Activation Particles (m2)
sc-425460-LAC-2 200 µL

gasdermin Lentiviral Activation Particles (m2)

Sign In for Pricing
View Details