Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Selenoprotein K (SELK), partial, Biotinylated

This Recombinant Human Selenoprotein K (SELK), partial, Biotinylated spans the amino acid sequence from region 43-94. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Selenoprotein K; SelK; SELENOK SELK HSPC030 HSPC297

UniProt

Q9Y6D0

Expression Region

43-94

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QQDVKKRRSYGNSSDSRYDDGRGPPGNPPRRMGRINHLRGPSPPPMAGGUGR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal EVI-1 Antibody (1E7.)
H00004197-M01 0.1 mg

Mouse Monoclonal EVI-1 Antibody (1E7.)

Sign In for Pricing
View Details
SPATA10 (C-11) PE
sc-390306 PE 200 µg/mL

SPATA10 (C-11) PE

Sign In for Pricing
View Details
Biotin-Linked Antibody to Solute Carrier Family 30 Member 8 (SLC30A8)
MBS2003795 Inquire

Biotin-Linked Antibody to Solute Carrier Family 30 Member 8 (SLC30A8)

Sign In for Pricing
View Details
Anti-Human AMH Monoclonal Antibody (1A377)
MBS1586534-01 0.05 mg

Anti-Human AMH Monoclonal Antibody (1A377)

Sign In for Pricing
View Details
Anti-Human AMH Monoclonal Antibody (1A377)
MBS1586534-02 0.1 mg

Anti-Human AMH Monoclonal Antibody (1A377)

Sign In for Pricing
View Details
Anti-Human AMH Monoclonal Antibody (1A377)
MBS1586534-03 5x 0.1 mg

Anti-Human AMH Monoclonal Antibody (1A377)

Sign In for Pricing
View Details