Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Protein Wnt-6 (WNT6), Biotinylated

This Recombinant Human Protein Wnt-6 (WNT6), Biotinylated spans the amino acid sequence from region 25-365. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Protein Wnt-6 WNT6

UniProt

Q9Y6F9

Expression Region

25-365

Origin

Homo sapiens (Human)

Field of Research

Stem Cell & Developmental Biology

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

LWWAVGSPLVMDPTSICRKARRLAGRQAELCQAEPEVVAELARGARLGVRECQFQFRFRRWNCSSHSKAFGRILQQDIRETAFVFAITAAGASHAVTQACSMGELLQCGCQAPRGRAPPRPSGLPGTPGPPGPAGSPEGSAAWEWGGCGDDVDFGDEKSRLFMDARHKRGRGDIRALVQLHNNEAGRLAVRSHTRTECKCHGLSGSCALRTCWQKLPPFREVGARLLERFHGASRVMGTNDGKALLPAVRTLKPPGRADLLYAADSPDFCAPNRRTGSPGTRGRACNSSAPDLSGCDLLCCGRGHRQESVQLEENCLCRFHWCCVVQCHRCRVRKELSLCL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

p53 (TP53) (NM_001126113) Human Over-expression Lysate
LC426653 20 µg

p53 (TP53) (NM_001126113) Human Over-expression Lysate

Sign In for Pricing
View Details
CD8A CytoSection
TS427316P5 25 Slides

CD8A CytoSection

Sign In for Pricing
View Details
4-Ethyl-2-pyridinecarbonitrile-d5
TRC-E925547-25MG 25 mg

4-Ethyl-2-pyridinecarbonitrile-d5

Sign In for Pricing
View Details
Ethyl Acetate-d8
TRC-E678351-50MG 50 mg

Ethyl Acetate-d8

Sign In for Pricing
View Details
OptiWell™ Sealing Mats for DW Plates
D3320-5S 50 Units/Pack

OptiWell™ Sealing Mats for DW Plates

Sign In for Pricing
View Details
MRP-14 (MRP14/840), 0.2mg/mL
BNUB0840-100 1x 100 µL

MRP-14 (MRP14/840), 0.2mg/mL

Sign In for Pricing
View Details