Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Protein Wnt-6 (WNT6), Biotinylated

This Recombinant Human Protein Wnt-6 (WNT6), Biotinylated spans the amino acid sequence from region 25-365. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Protein Wnt-6 WNT6

UniProt

Q9Y6F9

Expression Region

25-365

Origin

Homo sapiens (Human)

Field of Research

Stem Cell & Developmental Biology

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

LWWAVGSPLVMDPTSICRKARRLAGRQAELCQAEPEVVAELARGARLGVRECQFQFRFRRWNCSSHSKAFGRILQQDIRETAFVFAITAAGASHAVTQACSMGELLQCGCQAPRGRAPPRPSGLPGTPGPPGPAGSPEGSAAWEWGGCGDDVDFGDEKSRLFMDARHKRGRGDIRALVQLHNNEAGRLAVRSHTRTECKCHGLSGSCALRTCWQKLPPFREVGARLLERFHGASRVMGTNDGKALLPAVRTLKPPGRADLLYAADSPDFCAPNRRTGSPGTRGRACNSSAPDLSGCDLLCCGRGHRQESVQLEENCLCRFHWCCVVQCHRCRVRKELSLCL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

USHBP1 (NM_031941) Human Recombinant Protein
PROTQ8N6Y0 20 µg

USHBP1 (NM_031941) Human Recombinant Protein

Sign In for Pricing
View Details
Mouse Chromogranin A (CHGA) ELISA Kit
MBS2703017-01 24 Strip Well

Mouse Chromogranin A (CHGA) ELISA Kit

Sign In for Pricing
View Details
Mouse Chromogranin A (CHGA) ELISA Kit
MBS2703017-02 48 Well

Mouse Chromogranin A (CHGA) ELISA Kit

Sign In for Pricing
View Details
Mouse Chromogranin A (CHGA) ELISA Kit
MBS2703017-03 96 Well

Mouse Chromogranin A (CHGA) ELISA Kit

Sign In for Pricing
View Details
Mouse Chromogranin A (CHGA) ELISA Kit
MBS2703017-04 5x 96 Well

Mouse Chromogranin A (CHGA) ELISA Kit

Sign In for Pricing
View Details
Mouse Chromogranin A (CHGA) ELISA Kit
MBS2703017-05 10x 96 Well

Mouse Chromogranin A (CHGA) ELISA Kit

Sign In for Pricing
View Details