Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Testis-expressed protein 264 (TX264), partial, Biotinylated

This Recombinant Human Testis-expressed protein 264 (TX264), partial, Biotinylated spans the amino acid sequence from region 32-313. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Testis-expressed protein 264; Putative secreted protein Zsig11; TEX264 ZSIG11 UNQ337/PRO536

UniProt

Q9Y6I9

Expression Region

32-313

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

AGVEVSAGSPPIRNVTVAYKFHMGLYGETGRLFTESCSISPKLRSIAVYYDNPHMVPPDKCRCAVGSILSEGEESPSPELIDLYQKFGFKVFSFPAPSHVVTATFPYTTILSIWLATRRVHPALDTYIKERKLCAYPRLEIYQEDQIHFMCPLARQGDFYVPEMKETEWKWRGLVEAIDTQVDGTGADTMSDTSSVSLEVSPGSRETSAATLSPGASSRGWDDGDTRSEHSYSESGASGSSFEELDLEGEGPLGESRLDPGTEPLGTTKWLWEPTAPEKGKE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ezrin / p81 (CPTC-Ezrin-1), CF647 conjugate, 0.1mg/mL
BNC472238-100 1x 100 µL

Ezrin / p81 (CPTC-Ezrin-1), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
2-Acetylfuran
TRC-A176200-1G 1 g

2-Acetylfuran

Sign In for Pricing
View Details
APC Anti-Human CD27 Antibody[O323]
E-AB-F1140E-01 20 Tests

APC Anti-Human CD27 Antibody[O323]

Sign In for Pricing
View Details
APC Anti-Human CD27 Antibody[O323]
E-AB-F1140E-02 100 Tests

APC Anti-Human CD27 Antibody[O323]

Sign In for Pricing
View Details
APC Anti-Human CD27 Antibody[O323]
E-AB-F1140E-03 2x 100 Tests

APC Anti-Human CD27 Antibody[O323]

Sign In for Pricing
View Details
Wedelolactone
TRC-W980008-25MG 25 mg

Wedelolactone

Sign In for Pricing
View Details