Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Choline/ethanolaminephosphotransferase 1 (CEPT1), partial, Biotinylated

This Recombinant Human Choline/ethanolaminephosphotransferase 1 (CEPT1), partial, Biotinylated spans the amino acid sequence from region 1-88. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Choline/ethanolaminephosphotransferase 1; hCEPT1; EC 2.7.8.1; EC 2.7.8.2; 1-alkenyl-2-acylglycerol choline phosphotransferase; EC 2.7.8.22; CEPT1 PRO1101

UniProt

Q9Y6K0

Expression Region

1-88

Origin

Homo sapiens (Human)

Field of Research

Metabolism Research; Pharmacology & Drug Discovery

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MSGHRSTRKRCGDSHPESPVGFGHMSTTGCVLNKLFQLPTPPLSRHQLKRLEEHRYQSAGRSLLEPLMQGYWEWLVRRVPSWIAPNLI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat SMURF2 (Smad Specific E3 Ubiquitin Protein Ligase 2) ELISA Kit
EK247575 96 Well

Rat SMURF2 (Smad Specific E3 Ubiquitin Protein Ligase 2) ELISA Kit

Sign In for Pricing
View Details
Imperatoxin A TFA
orb2663336-01 10 mg

Imperatoxin A TFA

Sign In for Pricing
View Details
Imperatoxin A TFA
orb2663336-02 50 mg

Imperatoxin A TFA

Sign In for Pricing
View Details
POMZP3, NT (POMZP3, POM121 and ZP3 fusion protein) (MaxLight 750)
MBS6335871-01 0.1 mL

POMZP3, NT (POMZP3, POM121 and ZP3 fusion protein) (MaxLight 750)

Sign In for Pricing
View Details
POMZP3, NT (POMZP3, POM121 and ZP3 fusion protein) (MaxLight 750)
MBS6335871-02 5x 0.1 mL

POMZP3, NT (POMZP3, POM121 and ZP3 fusion protein) (MaxLight 750)

Sign In for Pricing
View Details
Human CD368/CLEC4D Recombinant Protein (N-Fc)
HV778021-01 50 µg

Human CD368/CLEC4D Recombinant Protein (N-Fc)

Sign In for Pricing
View Details