Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Choline/ethanolaminephosphotransferase 1 (CEPT1), partial, Biotinylated

This Recombinant Human Choline/ethanolaminephosphotransferase 1 (CEPT1), partial, Biotinylated spans the amino acid sequence from region 1-88. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Choline/ethanolaminephosphotransferase 1; hCEPT1; EC 2.7.8.1; EC 2.7.8.2; 1-alkenyl-2-acylglycerol choline phosphotransferase; EC 2.7.8.22; CEPT1 PRO1101

UniProt

Q9Y6K0

Expression Region

1-88

Origin

Homo sapiens (Human)

Field of Research

Metabolism Research; Pharmacology & Drug Discovery

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MSGHRSTRKRCGDSHPESPVGFGHMSTTGCVLNKLFQLPTPPLSRHQLKRLEEHRYQSAGRSLLEPLMQGYWEWLVRRVPSWIAPNLI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human Putative glycine N-acyltransferase-like protein 1B (GLYLB)
orb3009326-01 20 µg

Recombinant Human Putative glycine N-acyltransferase-like protein 1B (GLYLB)

Sign In for Pricing
View Details
Recombinant Human Putative glycine N-acyltransferase-like protein 1B (GLYLB)
orb3009326-02 100 µg

Recombinant Human Putative glycine N-acyltransferase-like protein 1B (GLYLB)

Sign In for Pricing
View Details
Recombinant Human Putative glycine N-acyltransferase-like protein 1B (GLYLB)
orb3009326-03 1 mg

Recombinant Human Putative glycine N-acyltransferase-like protein 1B (GLYLB)

Sign In for Pricing
View Details
Hsa-miR-365b-5p miRNA Antagomir
orb1914401-01 10 nmol

Hsa-miR-365b-5p miRNA Antagomir

Sign In for Pricing
View Details
Hsa-miR-365b-5p miRNA Antagomir
orb1914401-02 20 nmol

Hsa-miR-365b-5p miRNA Antagomir

Sign In for Pricing
View Details
Mouse Retinoic acid inducible gene/RIG-like receptor ELISA Kit
MBS732265-01 48 Well

Mouse Retinoic acid inducible gene/RIG-like receptor ELISA Kit

Sign In for Pricing
View Details