Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Protein piccolo (PCLO), partial, Biotinylated

This Recombinant Human Protein piccolo (PCLO), partial, Biotinylated spans the amino acid sequence from region 4694-4823. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Protein piccolo; Aczonin; PCLO ACZ KIAA0559

UniProt

Q9Y6V0

Expression Region

4694-4823

Origin

Homo sapiens (Human)

Field of Research

Neuroscience

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

ITGEIQLQINYDLGNLIIHILQARNLVPRDNNGYSDPFVKVYLLPGRGQVMVVQNASAEYKRRTKHVQKSLNPEWNQTVIYKSISMEQLKKKTLEVTVWDYDRFSSNDFLGEVLIDLSSTSHLDNTPRWY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal GFAP Antibody (rGFAP/9150)
NBP3-23853-100ug 100 µg

Mouse Monoclonal GFAP Antibody (rGFAP/9150)

Sign In for Pricing
View Details
PARD3A Double Nickase Plasmid (m)
sc-430042-NIC 20 µg

PARD3A Double Nickase Plasmid (m)

Sign In for Pricing
View Details
Rabbit anti-Escherichia coli O157:H7 hisD Polyclonal Antibody
MBS9005964 Inquire

Rabbit anti-Escherichia coli O157:H7 hisD Polyclonal Antibody

Sign In for Pricing
View Details
Olr165 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)
LV629620 1.0 µg DNA

Olr165 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)

Sign In for Pricing
View Details
Elosulfase alfa
T82477-01 1 mg

Elosulfase alfa

Sign In for Pricing
View Details
Elosulfase alfa
T82477-02 5 mg

Elosulfase alfa

Sign In for Pricing
View Details