Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Bis (5'-adenosyl) -triphosphatase ENPP4 (ENPP4), partial, Biotinylated

This Recombinant Human Bis (5'-adenosyl) -triphosphatase ENPP4 (ENPP4), partial, Biotinylated spans the amino acid sequence from region 16-407. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Bis (5'-adenosyl-triphosphatase ENPP4; EC 3.6.1.29; AP3A hydrolase; AP3Aase; Ectonucleotide pyrophosphatase/phosphodiesterase family member 4; E-NPP 4; NPP-4; ENPP4 KIAA0879 NPP4

UniProt

Q9Y6X5

Expression Region

16-407

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

FRSDSSSSLPPKLLLVSFDGFRADYLKNYEFPHLQNFIKEGVLVEHVKNVFITKTFPNHYSIVTGLYEESHGIVANSMYDAVTKKHFSDSNDKDPFWWNEAVPIWVTNQLQENRSSAAAMWPGTDVPIHDTISSYFMNYNSSVSFEERLNNITMWLNNSNPPVTFATLYWEEPDASGHKYGPEDKENMSRVLKKIDDLIGDLVQRLKMLGLWENLNVIITSDHGMTQCSQDRLINLDSCIDHSYYTLIDLSPVAAILPKINRTEVYNKLKNCSPHMNVYLKEDIPNRFYYQHNDRIQPIILVADEGWTIVLNESSQKLGDHGYDNSLPSMHPFLAAHGPAFHKGYKHSTINIVDIYPMMCHILGLKPHPNNGTFGHTKCLLVDQWCINLPEA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PE Anti-Human CD14 Antibody[1B10]
AN00213D-01 20 Tests

PE Anti-Human CD14 Antibody[1B10]

Sign In for Pricing
View Details
PE Anti-Human CD14 Antibody[1B10]
AN00213D-02 100 Tests

PE Anti-Human CD14 Antibody[1B10]

Sign In for Pricing
View Details
PE Anti-Human CD14 Antibody[1B10]
AN00213D-03 2x 100 Tests

PE Anti-Human CD14 Antibody[1B10]

Sign In for Pricing
View Details
TMEM145 Antibody
8G775-AAT 50 µg

TMEM145 Antibody

Sign In for Pricing
View Details
GAPDHS Rabbit Polyclonal Antibody
TA376480 100 µL

GAPDHS Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Mouse IL-7 Recombinant Rabbit monoclonal Antibody
HA723621 100 µL

Mouse IL-7 Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details