Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor alpha variable 27 (TVA27), Biotinylated

This Recombinant Human T cell receptor alpha variable 27 (TVA27), Biotinylated spans the amino acid sequence from region 20-109. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor alpha variable 27 TRAV27

UniProt

A0A087WT01

Expression Region

20-109

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QLLEQSPQFLSIQEGENLTVYCNSSSVFSSLQWYRQEPGEGPVLLVTVVTGGEVKKLKRLTFQFGDARKDSSLHITAAQTGDTGLYLCAG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NF-H Polyclonal Antibody, AbBy Fluor™ 680 Conjugated
bs-10680R-BF680-TR 20 µL

NF-H Polyclonal Antibody, AbBy Fluor™ 680 Conjugated

Sign In for Pricing
View Details
LRRC3 (NM_030891) Human Mass Spec Standard
PH319180 10 µg

LRRC3 (NM_030891) Human Mass Spec Standard

Sign In for Pricing
View Details
Olfr1386 sgRNA CRISPR Lentivector (Mouse) (Target 2)
K4147003 1.0 µg DNA

Olfr1386 sgRNA CRISPR Lentivector (Mouse) (Target 2)

Sign In for Pricing
View Details
FAM78B shRNA Plasmid (h)
sc-88751-SH 20 µg

FAM78B shRNA Plasmid (h)

Sign In for Pricing
View Details
Tmem66 siRNA Oligos set (Mouse)
47080174 3x 5 nmol

Tmem66 siRNA Oligos set (Mouse)

Sign In for Pricing
View Details
Rdh9 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 1)
K3240306 1.0 µg DNA

Rdh9 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 1)

Sign In for Pricing
View Details