Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Small integral membrane protein 26 (SIM26), partial, Biotinylated

This Recombinant Human Small integral membrane protein 26 (SIM26), partial, Biotinylated spans the amino acid sequence from region 36-95. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Small integral membrane protein 26 SMIM26 LINC00493

UniProt

A0A096LP01

Expression Region

36-95

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

AKSSVDQKDGSASEVPSELSERPKGFYVETVVTYKEDFVPNTEKILNYWKSWTGGPGTEP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Wdr74 Pre-designed siRNA Set A
SI215961A 1 Each

Rat Wdr74 Pre-designed siRNA Set A

Sign In for Pricing
View Details
XRCC6BP1 (ATP23) (NM_033276) Human Over-expression Lysate
LS091419 100 µg

XRCC6BP1 (ATP23) (NM_033276) Human Over-expression Lysate

Sign In for Pricing
View Details
ZNF620 Human shRNA Plasmid Kit (Locus ID 253639)
TL300096 1 Kit

ZNF620 Human shRNA Plasmid Kit (Locus ID 253639)

Sign In for Pricing
View Details
Mouse 4-Hydroxynonenal (4-HNE) ELISA Kit
MBS2612583-01 48 Well

Mouse 4-Hydroxynonenal (4-HNE) ELISA Kit

Sign In for Pricing
View Details
Mouse 4-Hydroxynonenal (4-HNE) ELISA Kit
MBS2612583-02 96 Well

Mouse 4-Hydroxynonenal (4-HNE) ELISA Kit

Sign In for Pricing
View Details
Mouse 4-Hydroxynonenal (4-HNE) ELISA Kit
MBS2612583-03 5x 96 Well

Mouse 4-Hydroxynonenal (4-HNE) ELISA Kit

Sign In for Pricing
View Details