Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Protein myomixer (MYMX), partial, Biotinylated

This Recombinant Human Protein myomixer (MYMX), partial, Biotinylated spans the amino acid sequence from region 26-84. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Protein myomixer; Microprotein inducer of fusion; Protein minion; hMINION; MYMX

UniProt

A0A1B0GTQ4

Expression Region

26-84

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

RQYLLPLLRRLARRLGSQDMREALLGCLLFILSQRHSPDAGEASRVDRLERRERLGPQK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rhodamine B
TRC-R318605-500G 500 g

Rhodamine B

Sign In for Pricing
View Details
CNTF Receptor alpha (CNTFR) (NM_147164) Human Over-expression Lysate
LY403449 100 µg

CNTF Receptor alpha (CNTFR) (NM_147164) Human Over-expression Lysate

Sign In for Pricing
View Details
Cysteine Dioxygenase Type 1 (CDO1) (NM_001801) Human Over-expression Lysate
LY419737 100 µg

Cysteine Dioxygenase Type 1 (CDO1) (NM_001801) Human Over-expression Lysate

Sign In for Pricing
View Details
HOXD9 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI4H10]
TA809664BM 100 µL

HOXD9 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI4H10]

Sign In for Pricing
View Details
Frozen Tissue Sections, Ovary: right
CS633290 5x 5 µm

Frozen Tissue Sections, Ovary: right

Sign In for Pricing
View Details
Tissue FFPE Sections, Ileum
CS807279 5x 5 µm

Tissue FFPE Sections, Ileum

Sign In for Pricing
View Details