Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Protein myomixer (MYMX), partial, Biotinylated

This Recombinant Human Protein myomixer (MYMX), partial, Biotinylated spans the amino acid sequence from region 26-84. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Protein myomixer; Microprotein inducer of fusion; Protein minion; hMINION; MYMX

UniProt

A0A1B0GTQ4

Expression Region

26-84

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

RQYLLPLLRRLARRLGSQDMREALLGCLLFILSQRHSPDAGEASRVDRLERRERLGPQK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

2-Amino-4,5,6,7,8-pentahydrothiazolo[5,4-d]azepine
MBS6029836-01 25 mg

2-Amino-4,5,6,7,8-pentahydrothiazolo[5,4-d]azepine

Sign In for Pricing
View Details
2-Amino-4,5,6,7,8-pentahydrothiazolo[5,4-d]azepine
MBS6029836-02 5x 25 mg

2-Amino-4,5,6,7,8-pentahydrothiazolo[5,4-d]azepine

Sign In for Pricing
View Details
PRG2 Rabbit Polyclonal Antibody (BF350)
orb2549210 100 µL

PRG2 Rabbit Polyclonal Antibody (BF350)

Sign In for Pricing
View Details
FGF17 Antibody, Biotin conjugated
A21900-50UG 50 µg

FGF17 Antibody, Biotin conjugated

Sign In for Pricing
View Details
Human DGAT2 (Diacylglycerol-O-Acyltransferase Homolog 2) ELISA Kit
EH26158 96 Tests

Human DGAT2 (Diacylglycerol-O-Acyltransferase Homolog 2) ELISA Kit

Sign In for Pricing
View Details
FHL-3 Double Nickase Plasmid (m2)
sc-420352-NIC-2 20 µg

FHL-3 Double Nickase Plasmid (m2)

Sign In for Pricing
View Details