Recombinant Human Small regulatory polypeptide of amino acid response (SPAR), partial, Biotinylated
This Recombinant Human Small regulatory polypeptide of amino acid response (SPAR), partial, Biotinylated spans the amino acid sequence from region 40-90. Purity: Greater than 85% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
Small regulatory polypeptide of amino acid response SPAAR LINC00961 SPAR
UniProt
A0A1B0GVQ0
Expression Region
40-90
Origin
Homo sapiens (Human)
Endotoxin
Not test
Purity
Greater than 85% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Storage Conditions
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
AA Sequence
CFSCDSRAQDPQGGPGRSFTVATFRQEASLFTGPVRHAQPVPSAQDFWTFM
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
037136-ML750 100 µL
ITGA5, ID (ITGA5, FNRA, Integrin alpha-5, CD49 antigen-like family member E, Fibronectin receptor subunit alpha, Integrin alpha-F, VLA-5, CD49e, Integrin alpha-5 heavy chain, Integrin alpha-5 light chain) (MaxLight 750) discontinued
Sign In for Pricing
View Details 
