Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin kappa variable 2-29 (KV229), Biotinylated

This Recombinant Human Immunoglobulin kappa variable 2-29 (KV229), Biotinylated spans the amino acid sequence from region 21-120. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin kappa variable 2-29 IGKV2-29

UniProt

A2NJV5

Expression Region

21-120

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

DIVMTQTPLSLSVTPGQPASISCKSSQSLLHSDGKTYLYWYLQKPGQSPQLLIYEVSSRFSGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCMQGIHLP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

AIF1 / Iba1 (Microglia Marker) (rAIF1/1909), CF647 conjugate, 0.1mg/mL
BNC472346-100 1x 100 µL

AIF1 / Iba1 (Microglia Marker) (rAIF1/1909), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
SDK2 Human Gene Knockout Kit (CRISPR)
KN427752 1 Kit

SDK2 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
APRIL Antibody
KC-22085-01 50 μL

APRIL Antibody

Sign In for Pricing
View Details
APRIL Antibody
KC-22085-02 100 µL

APRIL Antibody

Sign In for Pricing
View Details
APRIL Antibody
KC-22085-03 1 mL

APRIL Antibody

Sign In for Pricing
View Details
Uncoated Human CTLA4 (Cytotoxic T-Lymphocyte Associated Antigen 4) ELISA Kit
E-UNEL-H0381-01 5x 96 Tests

Uncoated Human CTLA4 (Cytotoxic T-Lymphocyte Associated Antigen 4) ELISA Kit

Sign In for Pricing
View Details