Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin kappa variable 2-29 (KV229), Biotinylated

This Recombinant Human Immunoglobulin kappa variable 2-29 (KV229), Biotinylated spans the amino acid sequence from region 21-120. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin kappa variable 2-29 IGKV2-29

UniProt

A2NJV5

Expression Region

21-120

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

DIVMTQTPLSLSVTPGQPASISCKSSQSLLHSDGKTYLYWYLQKPGQSPQLLIYEVSSRFSGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCMQGIHLP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Single Frequency type Ultrasonic Cleaner BULC-715
BULC-715 Each

Single Frequency type Ultrasonic Cleaner BULC-715

Sign In for Pricing
View Details
Vasopressin V1b receptor (AVPR1B) (NM_000707) Human Over-expression Lysate
LC400237 20 µg

Vasopressin V1b receptor (AVPR1B) (NM_000707) Human Over-expression Lysate

Sign In for Pricing
View Details
JUNB pSer79 Rabbit Polyclonal Antibody
AP01623PU-N 100 µg

JUNB pSer79 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Mecamylamine-d3 Hydrochloride
TRC-M202602-1MG 1 mg

Mecamylamine-d3 Hydrochloride

Sign In for Pricing
View Details
(R)-Reticuline (>80% ee)
TRC-R188505-5MG 5 mg

(R)-Reticuline (>80% ee)

Sign In for Pricing
View Details
BDH1 Polyclonal Antibody
E-AB-14789-01 20 µL

BDH1 Polyclonal Antibody

Sign In for Pricing
View Details