Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin kappa variable 2-29 (KV229), Biotinylated

This Recombinant Human Immunoglobulin kappa variable 2-29 (KV229), Biotinylated spans the amino acid sequence from region 21-120. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin kappa variable 2-29 IGKV2-29

UniProt

A2NJV5

Expression Region

21-120

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

DIVMTQTPLSLSVTPGQPASISCKSSQSLLHSDGKTYLYWYLQKPGQSPQLLIYEVSSRFSGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCMQGIHLP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cryopyrin Lentiviral Activation Particles (h2)
sc-400270-LAC-2 200 µL

Cryopyrin Lentiviral Activation Particles (h2)

Sign In for Pricing
View Details
Mouse Monoclonal p120-catenin Antibody (25a) [DyLight 650]
NBP2-54411C 100 µL

Mouse Monoclonal p120-catenin Antibody (25a) [DyLight 650]

Sign In for Pricing
View Details
Gli3 Recombinant Rabbit Monoclonal Antibody [JG83-39]
ET7108-68 100 µL

Gli3 Recombinant Rabbit Monoclonal Antibody [JG83-39]

Sign In for Pricing
View Details
Recombinant Drosophila persimilis Calcium channel flower (flower)
MBS7014936-01 0.02 mg

Recombinant Drosophila persimilis Calcium channel flower (flower)

Sign In for Pricing
View Details
Recombinant Drosophila persimilis Calcium channel flower (flower)
MBS7014936-02 0.1 mg

Recombinant Drosophila persimilis Calcium channel flower (flower)

Sign In for Pricing
View Details
Recombinant Drosophila persimilis Calcium channel flower (flower)
MBS7014936-03 5x 0.1 mg

Recombinant Drosophila persimilis Calcium channel flower (flower)

Sign In for Pricing
View Details