Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Nascent polypeptide-associated complex subunit alpha, muscle-specific form (NACAM), partial, Biotinylated

This Recombinant Human Nascent polypeptide-associated complex subunit alpha, muscle-specific form (NACAM), partial, Biotinylated spans the amino acid sequence from region 1933-1998. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Nascent polypeptide-associated complex subunit alpha, muscle-specific form; Alpha-NAC, muscle-specific form; skNAC; NACA

UniProt

E9PAV3

Expression Region

1933-1998

Origin

Homo sapiens (Human)

Field of Research

Musculoskeletal & Connective Tissue Research

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

SRSEKKARKAMSKLGLRQVTGVTRVTIRKSKNILFVITKPDVYKSPASDTYIVFGEAKIEDLSQQA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Muffle Box Furnace BFMF-950-3
BFMF-950-3 1 Unit

Muffle Box Furnace BFMF-950-3

Sign In for Pricing
View Details
Mouse Putative Mitochondrial Transporter UCP3 (UCP3) Protein
abx659282-01 10 µg

Mouse Putative Mitochondrial Transporter UCP3 (UCP3) Protein

Sign In for Pricing
View Details
Mouse Putative Mitochondrial Transporter UCP3 (UCP3) Protein
abx659282-02 50 µg

Mouse Putative Mitochondrial Transporter UCP3 (UCP3) Protein

Sign In for Pricing
View Details
Mouse Putative Mitochondrial Transporter UCP3 (UCP3) Protein
abx659282-03 100 µg

Mouse Putative Mitochondrial Transporter UCP3 (UCP3) Protein

Sign In for Pricing
View Details
Mouse Putative Mitochondrial Transporter UCP3 (UCP3) Protein
abx659282-04 200 µg

Mouse Putative Mitochondrial Transporter UCP3 (UCP3) Protein

Sign In for Pricing
View Details
Mouse Putative Mitochondrial Transporter UCP3 (UCP3) Protein
abx659282-05 500 µg

Mouse Putative Mitochondrial Transporter UCP3 (UCP3) Protein

Sign In for Pricing
View Details