Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Nascent polypeptide-associated complex subunit alpha, muscle-specific form (NACAM), partial, Biotinylated

This Recombinant Human Nascent polypeptide-associated complex subunit alpha, muscle-specific form (NACAM), partial, Biotinylated spans the amino acid sequence from region 1933-1998. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Nascent polypeptide-associated complex subunit alpha, muscle-specific form; Alpha-NAC, muscle-specific form; skNAC; NACA

UniProt

E9PAV3

Expression Region

1933-1998

Origin

Homo sapiens (Human)

Field of Research

Musculoskeletal & Connective Tissue Research

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

SRSEKKARKAMSKLGLRQVTGVTRVTIRKSKNILFVITKPDVYKSPASDTYIVFGEAKIEDLSQQA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lsm1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)
27738114 3x 1.0 µg

Lsm1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)

Sign In for Pricing
View Details
Olfr1428 ORF Vector (Mouse) (pORF)
ORF052333 1.0 µg DNA

Olfr1428 ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details
2310039H08Rik Protein Lysate (Mouse) with C-HA Tag
10397034 100 µg

2310039H08Rik Protein Lysate (Mouse) with C-HA Tag

Sign In for Pricing
View Details
Mouse Monoclonal MGC20410 Antibody (PCRP-BATF2-2B9) [Alexa Fluor 405]
NBP3-20913AF405 0.1 mL

Mouse Monoclonal MGC20410 Antibody (PCRP-BATF2-2B9) [Alexa Fluor 405]

Sign In for Pricing
View Details
IDE Peptide - N-terminal region (AAP30652)
AAP30652-100UG 100 µg

IDE Peptide - N-terminal region (AAP30652)

Sign In for Pricing
View Details
5-Vinyl-5H-thianthren-5-ium Tetrafluoroborate
PC1008663-01 1 g

5-Vinyl-5H-thianthren-5-ium Tetrafluoroborate

Sign In for Pricing
View Details