Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human CNK3/IPCEF1 fusion protein (CNIPF), partial, Biotinylated

This Recombinant Human CNK3/IPCEF1 fusion protein (CNIPF), partial, Biotinylated spans the amino acid sequence from region 332-457. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

CNK3/IPCEF1 fusion protein CNK3/IPCEF1

UniProt

G9CGD6

Expression Region

332-457

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

TSLKKEKSAILDLYIPPPPAVPYSPRDENGSFVYGGSSKCKQPLPGPKGSESPNSFLDQESRRRRFTIADSDQLPGYSVETNILPTKMREKTPSYGKPRPLSMPADGNWMGIVDPFARPRGHGRKA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

STARD7-AS1 Human Gene Knockout Kit (CRISPR)
KN410999 1 Kit

STARD7-AS1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
KLKP1, NT (KLKP1, KLK31P, Putative protein KRIP1, Kallikrein-related in prostate protein 1, Kallikrein-related mRNA protein) (MaxLight 750) discontinued
037576-ML750 100 µL

KLKP1, NT (KLKP1, KLK31P, Putative protein KRIP1, Kallikrein-related in prostate protein 1, Kallikrein-related mRNA protein) (MaxLight 750) discontinued

Sign In for Pricing
View Details
Mouse Anti-Human IgA - Alexa Fluor 790
DL87645A-01 100 µL

Mouse Anti-Human IgA - Alexa Fluor 790

Sign In for Pricing
View Details
Mouse Anti-Human IgA - Alexa Fluor 790
DL87645A-02 500 µL

Mouse Anti-Human IgA - Alexa Fluor 790

Sign In for Pricing
View Details
Mouse Anti-Human IgA - Alexa Fluor 790
DL87645A-03 1 mL

Mouse Anti-Human IgA - Alexa Fluor 790

Sign In for Pricing
View Details
ZNF607 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)
K2719307 1.0 µg DNA

ZNF607 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)

Sign In for Pricing
View Details